Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (3 families) |
Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein) automatically mapped to Pfam PF00542 |
Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [160198] (1 PDB entry) Uniprot Q9RST0 52-122 |
Domain d2zjq51: 2zjq 5:52-122 [154521] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 Representative structure protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjq51:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjq51 d.45.1.1 (5:52-122) Ribosomal protein L7/12, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} eektefdvvlidagaskinvikeirgitglglkeakdmsekggvlkegvakdeaekmkaq leaagarvelk
Timeline for d2zjq51:
View in 3D Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |