SCOPe 2.02: Domain d2zjq51: 2zjq 5:52-122

Lineage for d2zjq51 (2zjq 5:52-122)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)

6. Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160198] (1 PDB entry)
   Uniprot Q9RST0 52-122

8. Domain d2zjq51: 2zjq 5:52-122 [154521]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   Representative structure
   protein/RNA complex

Details for d2zjq51

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (5:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d2zjq51:

Sequence; same for both SEQRES and ATOM records:

>d2zjq51 d.45.1.1 (5:52-122) Ribosomal protein L7/12, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
eektefdvvlidagaskinvikeirgitglglkeakdmsekggvlkegvakdeaekmkaq
leaagarvelk

Timeline for d2zjq51:

• d2zjq51 first appeared in SCOP 1.75
  
• d2zjq51 appears in SCOPe 2.01
  
• d2zjq51 appears in SCOPe 2.03
  
• d2zjq51 appears in the current release, SCOPe 2.08