SCOPe 2.02: Domain d2zjq31: 2zjq 3:2-64

Lineage for d2zjq31 (2zjq 3:2-64)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.301: L35p-like [143033] (1 superfamily)
   core: alpha-beta(3)-alpha; 2layers a/b

4. Superfamily d.301.1: L35p-like [143034] (1 family)

5. Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
   Pfam PF01632

6. Protein Ribosomal protein L35p [143036] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
   Uniprot Q9RSW6 2-64

8. Domain d2zjq31: 2zjq 3:2-64 [154519]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   automatically matched to 2ZJR 3:2-64
   protein/RNA complex

Details for d2zjq31

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2zjq31:

Sequence; same for both SEQRES and ATOM records:

>d2zjq31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

Timeline for d2zjq31:

• d2zjq31 first appeared in SCOP 1.75
  
• d2zjq31 appears in SCOPe 2.01
  
• d2zjq31 appears in SCOPe 2.03
  
• d2zjq31 appears in the current release, SCOPe 2.08