Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.301: L35p-like [143033] (1 superfamily) core: alpha-beta(3)-alpha; 2layers a/b |
Superfamily d.301.1: L35p-like [143034] (1 family) |
Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein) Pfam PF01632 |
Protein Ribosomal protein L35p [143036] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [160056] (10 PDB entries) Uniprot Q9RSW6 2-64 |
Domain d2zjq31: 2zjq 3:2-64 [154519] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR 3:2-64 |
PDB Entry: 2zjq (more details), 3.3 Å
SCOP Domain Sequences for d2zjq31:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjq31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]} pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm lpr
Timeline for d2zjq31:
View in 3D Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |