Lineage for d2zjq21 (2zjq 2:1-46)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975611Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1975612Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 1975613Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 1975614Protein Ribosomal protein L34p [144323] (3 species)
  7. 1975615Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 1975618Domain d2zjq21: 2zjq 2:1-46 [154518]
    Other proteins in same PDB: d2zjq11, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR 2:1-46
    protein/RNA complex

Details for d2zjq21

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2zjq21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjq21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d2zjq21:

Click to download the PDB-style file with coordinates for d2zjq21.
(The format of our PDB-style files is described here.)

Timeline for d2zjq21: