![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
![]() | Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
![]() | Protein Ribosomal protein L34p [144323] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries) Uniprot Q9RSH2 1-46 |
![]() | Domain d2zjq21: 2zjq 2:1-46 [154518] Other proteins in same PDB: d2zjq11, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR 2:1-46 protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjq21:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjq21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]} mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
Timeline for d2zjq21:
![]() Domains from other chains: (mouse over for more information) d2zjq11, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |