Lineage for d2zjpw1 (2zjp W:1-55)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864307Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 864308Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 864309Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 864352Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 864353Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
    Uniprot Q9RSL0 1-55
  8. 864358Domain d2zjpw1: 2zjp W:1-55 [154515]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpy1
    automatically matched to 2ZJR W:1-55
    complexed with mg, nsh, zn

Details for d2zjpw1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (W:) 50S ribosomal protein L30

SCOP Domain Sequences for d2zjpw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpw1 d.59.1.1 (W:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

SCOP Domain Coordinates for d2zjpw1:

Click to download the PDB-style file with coordinates for d2zjpw1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpw1: