Lineage for d2zjpt1 (2zjp T:2-85)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2083045Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2083046Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 2083047Protein Ribosomal protein L27 [110326] (3 species)
  7. 2083048Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
    Uniprot Q9RY65 2-85
  8. 2083054Domain d2zjpt1: 2zjp T:2-85 [154512]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR T:2-85
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpt1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (T:) 50S ribosomal protein L27

SCOPe Domain Sequences for d2zjpt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpt1 b.84.4.1 (T:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOPe Domain Coordinates for d2zjpt1:

Click to download the PDB-style file with coordinates for d2zjpt1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpt1: