Lineage for d2zjpr1 (2zjp R:4-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310711Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1310712Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 1310755Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 1310756Species Deinococcus radiodurans [TaxId:1299] [159024] (7 PDB entries)
    Uniprot Q9RXJ1 4-113
  8. 1310761Domain d2zjpr1: 2zjp R:4-113 [154510]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR R:4-113
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpr1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (R:) 50S ribosomal protein L24

SCOPe Domain Sequences for d2zjpr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]}
psagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkpsmt
npqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkt

SCOPe Domain Coordinates for d2zjpr1:

Click to download the PDB-style file with coordinates for d2zjpr1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpr1: