Lineage for d2zjpq1 (2zjp Q:2-94)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891281Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1891282Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1891283Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 1891284Protein Ribosomal protein L23 [54191] (4 species)
  7. 1891285Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
    Uniprot Q9RXK0 2-94
  8. 1891291Domain d2zjpq1: 2zjp Q:2-94 [154509]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR Q:2-94
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpq1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (Q:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2zjpq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

SCOPe Domain Coordinates for d2zjpq1:

Click to download the PDB-style file with coordinates for d2zjpq1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpq1: