Lineage for d2zjpp1 (2zjp P:8-134)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860696Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 860697Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 860698Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 860699Protein Ribosomal protein L22 [54845] (5 species)
  7. 860759Species Deinococcus radiodurans [TaxId:1299] [160265] (6 PDB entries)
    Uniprot Q9RXJ7 8-134
  8. 860764Domain d2zjpp1: 2zjp P:8-134 [154508]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR P:8-134
    complexed with mg, nsh, zn

Details for d2zjpp1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (P:) 50S ribosomal protein L22

SCOP Domain Sequences for d2zjpp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]}
frnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsasep
vakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshitii
vaekgnk

SCOP Domain Coordinates for d2zjpp1:

Click to download the PDB-style file with coordinates for d2zjpp1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpp1: