SCOP 1.75: Domain d2zjpo1: 2zjp O:5-98

Lineage for d2zjpo1 (2zjp O:5-98)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries)
   Uniprot Q9RY64 5-98

8. Domain d2zjpo1: 2zjp O:5-98 [154507]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR O:5-98
   complexed with mg, nsh, zn

Details for d2zjpo1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (O:) 50S ribosomal protein L21

SCOP Domain Sequences for d2zjpo1:

Sequence; same for both SEQRES and ATOM records:

>d2zjpo1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

Timeline for d2zjpo1:

• d2zjpo1 is new in SCOP 1.75
  
• d2zjpo1 appears in SCOPe 2.01
  
• d2zjpo1 appears in the current release, SCOPe 2.08