SCOPe 2.07: Domain d2zjpl1: 2zjp L:8-111

Lineage for d2zjpl1 (2zjp L:8-111)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
   Uniprot Q9RSL2 8-111

8. Domain d2zjpl1: 2zjp L:8-111 [154504]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR L:8-111
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpl1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (L:) 50S ribosomal protein L18

SCOPe Domain Sequences for d2zjpl1:

Sequence; same for both SEQRES and ATOM records:

>d2zjpl1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

Timeline for d2zjpl1:

• d2zjpl1 first appeared in SCOP 1.75
  
• d2zjpl1 appears in SCOPe 2.06
  
• d2zjpl1 appears in the current release, SCOPe 2.08