Lineage for d2zjpk1 (2zjp K:3-115)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238107Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 2238108Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 2238109Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 2238110Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 2238111Species Deinococcus radiodurans [TaxId:1299] [160268] (6 PDB entries)
    Uniprot Q9RSJ5 3-115
  8. 2238116Domain d2zjpk1: 2zjp K:3-115 [154503]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR K:3-115
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpk1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: Thiopeptide antibiotic Nosiheptide bound to the large ribosomal subunit of Deinococcus radiodurans
PDB Compounds: (K:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2zjpk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpk1 d.188.1.1 (K:3-115) Prokaryotic ribosomal protein L17 {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmaliel

SCOPe Domain Coordinates for d2zjpk1:

Click to download the PDB-style file with coordinates for d2zjpk1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpk1: