![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries) Uniprot Q9RXJ2 1-134 |
![]() | Domain d2zjph1: 2zjp H:1-134 [154500] Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1 automatically matched to 2ZJR H:1-134 protein/RNA complex; complexed with mg, no1, zn |
PDB Entry: 2zjp (more details), 3.7 Å
SCOPe Domain Sequences for d2zjph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjph1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]} mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd rrfmkivslapevl
Timeline for d2zjph1:
![]() Domains from other chains: (mouse over for more information) d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1 |