SCOP 1.75: Domain d2zjph1: 2zjp H:1-134

Lineage for d2zjph1 (2zjp H:1-134)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
   Uniprot Q9RXJ2 1-134

8. Domain d2zjph1: 2zjp H:1-134 [154500]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR H:1-134
   complexed with mg, nsh, zn

Details for d2zjph1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (H:) 50S ribosomal protein L14

SCOP Domain Sequences for d2zjph1:

Sequence; same for both SEQRES and ATOM records:

>d2zjph1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

Timeline for d2zjph1:

• d2zjph1 is new in SCOP 1.75
  
• d2zjph1 appears in SCOPe 2.01
  
• d2zjph1 appears in the current release, SCOPe 2.08