Lineage for d2zjpe2 (2zjp E:5-82)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584865Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2584866Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2584867Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2584868Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2584872Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
    Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172
  8. 2584882Domain d2zjpe2: 2zjp E:5-82 [154496]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR E:5-82
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpe2

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2zjpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpe2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdg

SCOPe Domain Coordinates for d2zjpe2:

Click to download the PDB-style file with coordinates for d2zjpe2.
(The format of our PDB-style files is described here.)

Timeline for d2zjpe2: