SCOPe 2.07: Domain d2zjpe1: 2zjp E:83-172

Lineage for d2zjpe1 (2zjp E:83-172)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
   Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172

8. Domain d2zjpe1: 2zjp E:83-172 [154495]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR E:83-172
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpe1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2zjpe1:

Sequence; same for both SEQRES and ATOM records:

>d2zjpe1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
ytinlelrgvgfrakltgkalemnigyshpviieppagvtfavpeptridvsgidkqlvg
qvaanvrkvrkpdayhgkgvrfvgeqialk

Timeline for d2zjpe1:

• d2zjpe1 first appeared in SCOP 1.75
  
• d2zjpe1 appears in SCOPe 2.06
  
• d2zjpe1 appears in the current release, SCOPe 2.08