Lineage for d2zjpd1 (2zjp D:3-179)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200932Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2200933Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2200934Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2200935Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2200939Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries)
    Uniprot Q9RXJ0 3-179
  8. 2200944Domain d2zjpd1: 2zjp D:3-179 [154494]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR D:3-179
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpd1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: Thiopeptide antibiotic Nosiheptide bound to the large ribosomal subunit of Deinococcus radiodurans
PDB Compounds: (D:) 50S ribosomal protein L5

SCOPe Domain Sequences for d2zjpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpd1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]}
qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl
qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf
dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

SCOPe Domain Coordinates for d2zjpd1:

Click to download the PDB-style file with coordinates for d2zjpd1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpd1: