Lineage for d2zjpa1 (2zjp A:128-272)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784449Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 1784450Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 1784454Species Deinococcus radiodurans [TaxId:1299] [159028] (5 PDB entries)
    Uniprot Q9RXJ9 128-272
  8. 1784458Domain d2zjpa1: 2zjp A:128-272 [154490]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR A:128-272
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpa1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2zjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpa1 b.34.5.3 (A:128-272) C-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
gnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelrrvhs
ecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgagrvpv
tpwgkptkglktrrkrktsdrfivt

SCOPe Domain Coordinates for d2zjpa1:

Click to download the PDB-style file with coordinates for d2zjpa1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpa1: