SCOPe 2.06: Domain d2zjp31: 2zjp 3:2-64

Lineage for d2zjp31 (2zjp 3:2-64)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.301: L35p-like [143033] (1 superfamily)
   core: alpha-beta(3)-alpha; 2layers a/b

4. Superfamily d.301.1: L35p-like [143034] (1 family)
   automatically mapped to Pfam PF01632

5. Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
   Pfam PF01632

6. Protein Ribosomal protein L35p [143036] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
   Uniprot Q9RSW6 2-64

8. Domain d2zjp31: 2zjp 3:2-64 [154488]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR 3:2-64
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjp31

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2zjp31:

Sequence; same for both SEQRES and ATOM records:

>d2zjp31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

Timeline for d2zjp31:

• d2zjp31 first appeared in SCOP 1.75
  
• d2zjp31 appears in SCOPe 2.05
  
• d2zjp31 appears in SCOPe 2.07
  
• d2zjp31 appears in the current release, SCOPe 2.08