Lineage for d2zjp21 (2zjp 2:1-46)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. 1714955Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1714956Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 1714957Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 1714958Protein Ribosomal protein L34p [144323] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 1714963Domain d2zjp21: 2zjp 2:1-46 [154487]
    Other proteins in same PDB: d2zjp11, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR 2:1-46
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjp21

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: Thiopeptide antibiotic Nosiheptide bound to the large ribosomal subunit of Deinococcus radiodurans
PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2zjp21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjp21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d2zjp21:

Click to download the PDB-style file with coordinates for d2zjp21.
(The format of our PDB-style files is described here.)

Timeline for d2zjp21: