Lineage for d2zjp11 (2zjp 1:2-54)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893376Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 893577Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 893578Protein Ribosomal protein L33p [144204] (3 species)
  7. 893579Species Deinococcus radiodurans [TaxId:1299] [161179] (6 PDB entries)
    Uniprot Q9RSS4 2-54
  8. 893584Domain d2zjp11: 2zjp 1:2-54 [154486]
    Other proteins in same PDB: d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR 1:2-54
    complexed with mg, nsh, zn

Details for d2zjp11

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (1:) 50S ribosomal protein L33

SCOP Domain Sequences for d2zjp11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjp11 g.41.8.6 (1:2-54) Ribosomal protein L33p {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOP Domain Coordinates for d2zjp11:

Click to download the PDB-style file with coordinates for d2zjp11.
(The format of our PDB-style files is described here.)

Timeline for d2zjp11: