Lineage for d2zhxj_ (2zhx J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1897032Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 1897033Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 1897034Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 1897037Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries)
  8. 1897073Domain d2zhxj_: 2zhx J: [154478]
    Other proteins in same PDB: d2zhxa_, d2zhxc_, d2zhxe_, d2zhxg_, d2zhxi_, d2zhxk_, d2zhxm_
    automated match to d1lqmh_
    protein/DNA complex

Details for d2zhxj_

PDB Entry: 2zhx (more details), 3.1 Å

PDB Description: crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor
PDB Compounds: (J:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2zhxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhxj_ d.17.5.1 (J:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOPe Domain Coordinates for d2zhxj_:

Click to download the PDB-style file with coordinates for d2zhxj_.
(The format of our PDB-style files is described here.)

Timeline for d2zhxj_: