SCOP 1.75: Domain d2zhxj1: 2zhx J:3-84

Lineage for d2zhxj1 (2zhx J:3-84)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries)

8. Domain d2zhxj1: 2zhx J:3-84 [154478]
   automatically matched to d1lqmh_

Details for d2zhxj1

PDB Entry: 2zhx, 3.1 Å

PDB Description: crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor

PDB Compounds: (J:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d2zhxj1:

Sequence; same for both SEQRES and ATOM records:

>d2zhxj1 d.17.5.1 (J:3-84) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

Timeline for d2zhxj1:

• d2zhxj1 is new in SCOP 1.75
  
• d2zhxj1 appears in SCOPe 2.01
  
• d2zhxj1 appears in the current release, SCOPe 2.08, called d2zhxj_