Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) has an additional strand at the C-terminus and a helix inserted after the first strand |
Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries) |
Domain d2zhxf_: 2zhx F: [154476] Other proteins in same PDB: d2zhxa_, d2zhxc_, d2zhxe_, d2zhxg_, d2zhxi_, d2zhxk_, d2zhxm_ automated match to d1lqmh_ protein/DNA complex |
PDB Entry: 2zhx (more details), 3.1 Å
SCOPe Domain Sequences for d2zhxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhxf_ d.17.5.1 (F:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda peykpwalviqdsngenkikml
Timeline for d2zhxf_: