Lineage for d2zhxf_ (2zhx F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1641602Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 1641603Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 1641604Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 1641607Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries)
  8. 1641641Domain d2zhxf_: 2zhx F: [154476]
    Other proteins in same PDB: d2zhxa_, d2zhxc_, d2zhxe_, d2zhxg_, d2zhxi_, d2zhxk_, d2zhxm_
    automated match to d1lqmh_
    protein/DNA complex

Details for d2zhxf_

PDB Entry: 2zhx (more details), 3.1 Å

PDB Description: crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor
PDB Compounds: (F:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2zhxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhxf_ d.17.5.1 (F:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
peykpwalviqdsngenkikml

SCOPe Domain Coordinates for d2zhxf_:

Click to download the PDB-style file with coordinates for d2zhxf_.
(The format of our PDB-style files is described here.)

Timeline for d2zhxf_: