Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Plasmid segregation protein ParM [82438] (1 species) |
Species Escherichia coli [TaxId:562] [82439] (6 PDB entries) |
Domain d2zhca2: 2zhc A:158-320 [154467] automatically matched to d1mwka2 complexed with adp, mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2zhc (more details), 23.8 Å
SCOPe Domain Sequences for d2zhca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhca2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm vigggaelicdavkkhtqirderffktnnsqydlvngmylign
Timeline for d2zhca2: