![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) ![]() |
![]() | Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins) decorated fold with a large insertion |
![]() | Domain d2zhba3: 2zhb A:258-437 [154465] Other proteins in same PDB: d2zhba1, d2zhba2 automated match to d1r89a3 protein/RNA complex; complexed with so4 |
PDB Entry: 2zhb (more details), 3.05 Å
SCOPe Domain Sequences for d2zhba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhba3 d.58.16.2 (A:258-437) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd
Timeline for d2zhba3: