SCOPe 2.04: Domain d2zhba3: 2zhb A:258-437

Lineage for d2zhba3 (2zhb A:258-437)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families)

5. Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
   decorated fold with a large insertion

6. Protein automated matches [254657] (1 species)
   not a true protein
7. Species Archaeoglobus fulgidus [TaxId:2234] [255727] (2 PDB entries)

8. Domain d2zhba3: 2zhb A:258-437 [154465]
   Other proteins in same PDB: d2zhba1, d2zhba2
   automated match to d1r89a3
   protein/RNA complex; complexed with so4

Details for d2zhba3

PDB Entry: 2zhb, 3.05 Å

PDB Description: Complex structure of AFCCA with tRNAminiDUC

PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zhba3:

Sequence; same for both SEQRES and ATOM records:

>d2zhba3 d.58.16.2 (A:258-437) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

Timeline for d2zhba3:

• d2zhba3 first appeared in SCOP 1.75
  
• d2zhba3 appears in SCOPe 2.03
  
• d2zhba3 appears in SCOPe 2.05
  
• d2zhba3 appears in the current release, SCOPe 2.08