Lineage for d2zhba2 (2zhb A:2-142)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686428Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 1686429Protein automated matches [227105] (4 species)
    not a true protein
  7. Species Archaeoglobus fulgidus [TaxId:2234] [255725] (2 PDB entries)
  8. 1686431Domain d2zhba2: 2zhb A:2-142 [154464]
    Other proteins in same PDB: d2zhba1, d2zhba3
    automated match to d1r89a2
    protein/RNA complex; complexed with so4

Details for d2zhba2

PDB Entry: 2zhb (more details), 3.05 Å

PDB Description: Complex structure of AFCCA with tRNAminiDUC
PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zhba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhba2 d.218.1.0 (A:2-142) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
vfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkepk
niksavdrtpfhhkwlegrik

SCOPe Domain Coordinates for d2zhba2:

Click to download the PDB-style file with coordinates for d2zhba2.
(The format of our PDB-style files is described here.)

Timeline for d2zhba2: