![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.0: automated matches [227287] (1 protein) not a true family |
![]() | Protein automated matches [227105] (6 species) not a true protein |
![]() | Domain d2zhba2: 2zhb A:2-142 [154464] Other proteins in same PDB: d2zhba1, d2zhba3 automated match to d1r89a2 protein/RNA complex; complexed with so4 |
PDB Entry: 2zhb (more details), 3.05 Å
SCOPe Domain Sequences for d2zhba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhba2 d.218.1.0 (A:2-142) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid vfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkepk niksavdrtpfhhkwlegrik
Timeline for d2zhba2: