SCOPe 2.04: Domain d2zhba1: 2zhb A:143-257

Lineage for d2zhba1 (2zhb A:143-257)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.0: automated matches [227288] (1 protein)
   not a true family
6. Protein automated matches [227106] (2 species)
   not a true protein
7. Species Archaeoglobus fulgidus [TaxId:2234] [255726] (2 PDB entries)

8. Domain d2zhba1: 2zhb A:143-257 [154463]
   Other proteins in same PDB: d2zhba2, d2zhba3
   automated match to d1r89a1
   protein/RNA complex; complexed with so4

Details for d2zhba1

PDB Entry: 2zhb, 3.05 Å

PDB Description: Complex structure of AFCCA with tRNAminiDUC

PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zhba1:

Sequence; same for both SEQRES and ATOM records:

>d2zhba1 a.160.1.0 (A:143-257) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d2zhba1:

• d2zhba1 first appeared in SCOP 1.75
  
• d2zhba1 appears in SCOPe 2.03
  
• d2zhba1 appears in SCOPe 2.05
  
• d2zhba1 appears in the current release, SCOPe 2.08