| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
| Family a.160.1.0: automated matches [227288] (1 protein) not a true family |
| Protein automated matches [227106] (2 species) not a true protein |
| Domain d2zhba1: 2zhb A:143-257 [154463] Other proteins in same PDB: d2zhba2, d2zhba3 automated match to d1r89a1 protein/RNA complex; complexed with so4 |
PDB Entry: 2zhb (more details), 3.05 Å
SCOPe Domain Sequences for d2zhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhba1 a.160.1.0 (A:143-257) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk
Timeline for d2zhba1: