Lineage for d2zhaa3 (2zha A:258-437)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909994Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 1910010Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. 1910011Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 1910012Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 1910039Domain d2zhaa3: 2zha A:258-437 [154462]
    Other proteins in same PDB: d2zhaa1, d2zhaa2
    automated match to d1r89a3
    protein/RNA complex; complexed with ctp, mg, so4

Details for d2zhaa3

PDB Entry: 2zha (more details), 2.95 Å

PDB Description: Complex structure of AFCCA with tRNAminiDU and CTP
PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zhaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhaa3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d2zhaa3:

Click to download the PDB-style file with coordinates for d2zhaa3.
(The format of our PDB-style files is described here.)

Timeline for d2zhaa3: