Lineage for d2zhaa1 (2zha A:143-257)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348647Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2348648Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2348673Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
    automatically mapped to Pfam PF09249
  6. 2348674Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 2348675Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries)
    Uniprot O28126
  8. 2348702Domain d2zhaa1: 2zha A:143-257 [154460]
    Other proteins in same PDB: d2zhaa2, d2zhaa3
    automated match to d1r89a1
    protein/RNA complex; complexed with ctp, mg, so4

Details for d2zhaa1

PDB Entry: 2zha (more details), 2.95 Å

PDB Description: Complex structure of AFCCA with tRNAminiDU and CTP
PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zhaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhaa1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOPe Domain Coordinates for d2zhaa1:

Click to download the PDB-style file with coordinates for d2zhaa1.
(The format of our PDB-style files is described here.)

Timeline for d2zhaa1: