| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
| Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein) automatically mapped to Pfam PF09249 |
| Protein tRNA nucleotidyltransferase, second domain [101275] (1 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries) Uniprot O28126 |
| Domain d2zhaa1: 2zha A:143-257 [154460] Other proteins in same PDB: d2zhaa2, d2zhaa3 automated match to d1r89a1 protein/RNA complex; complexed with ctp, mg, so4 |
PDB Entry: 2zha (more details), 2.95 Å
SCOPe Domain Sequences for d2zhaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhaa1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk
Timeline for d2zhaa1: