Lineage for d2zh9a2 (2zh9 A:1-142)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880450Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 880451Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 880677Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 880678Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 880679Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (28 PDB entries)
    Uniprot O28126
  8. 880705Domain d2zh9a2: 2zh9 A:1-142 [154458]
    Other proteins in same PDB: d2zh9a1, d2zh9a3
    automatically matched to d1r89a2
    complexed with so4

Details for d2zh9a2

PDB Entry: 2zh9 (more details), 2.9 Å

PDB Description: Complex structure of AFCCA with tRNAminiDU
PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2zh9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zh9a2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOP Domain Coordinates for d2zh9a2:

Click to download the PDB-style file with coordinates for d2zh9a2.
(The format of our PDB-style files is described here.)

Timeline for d2zh9a2: