SCOPe 2.07: Domain d2zh9a1: 2zh9 A:143-257

Lineage for d2zh9a1 (2zh9 A:143-257)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
   automatically mapped to Pfam PF09249

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries)
   Uniprot O28126

8. Domain d2zh9a1: 2zh9 A:143-257 [154457]
   Other proteins in same PDB: d2zh9a2, d2zh9a3
   automated match to d1r89a1
   protein/RNA complex; complexed with so4

Details for d2zh9a1

PDB Entry: 2zh9, 2.9 Å

PDB Description: Complex structure of AFCCA with tRNAminiDU

PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zh9a1:

Sequence; same for both SEQRES and ATOM records:

>d2zh9a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d2zh9a1:

• d2zh9a1 first appeared in SCOP 1.75
  
• d2zh9a1 appears in SCOPe 2.06
  
• d2zh9a1 appears in the current release, SCOPe 2.08