![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein) |
![]() | Protein tRNA nucleotidyltransferase, second domain [101275] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [101276] (28 PDB entries) Uniprot O28126 |
![]() | Domain d2zh9a1: 2zh9 A:143-257 [154457] Other proteins in same PDB: d2zh9a2, d2zh9a3 automatically matched to d1r89a1 protein/RNA complex; complexed with so4 |
PDB Entry: 2zh9 (more details), 2.9 Å
SCOPe Domain Sequences for d2zh9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zh9a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]} gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk
Timeline for d2zh9a1: