![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) ![]() |
![]() | Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins) decorated fold with a large insertion |
![]() | Domain d2zh7a3: 2zh7 A:258-437 [154453] Other proteins in same PDB: d2zh7a1, d2zh7a2 automated match to d1r89a3 protein/RNA complex; complexed with so4 |
PDB Entry: 2zh7 (more details), 3 Å
SCOPe Domain Sequences for d2zh7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zh7a3 d.58.16.2 (A:258-437) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd
Timeline for d2zh7a3: