Lineage for d2zh6a2 (2zh6 A:1-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007239Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 3007240Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 3007241Species Archaeoglobus fulgidus [TaxId:2234] [102942] (26 PDB entries)
    Uniprot O28126
  8. 3007255Domain d2zh6a2: 2zh6 A:1-142 [154449]
    Other proteins in same PDB: d2zh6a1, d2zh6a3
    automated match to d1r89a2
    protein/RNA complex; complexed with atp, mg, so4

Details for d2zh6a2

PDB Entry: 2zh6 (more details), 2.5 Å

PDB Description: Complex structure of AFCCA with tRNAminiDCU and ATP
PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zh6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zh6a2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOPe Domain Coordinates for d2zh6a2:

Click to download the PDB-style file with coordinates for d2zh6a2.
(The format of our PDB-style files is described here.)

Timeline for d2zh6a2: