Lineage for d2zh5a1 (2zh5 A:143-257)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779494Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 779495Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 779516Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
  6. 779517Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 779518Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (28 PDB entries)
    Uniprot O28126
  8. 779537Domain d2zh5a1: 2zh5 A:143-257 [154445]
    Other proteins in same PDB: d2zh5a2, d2zh5a3
    automatically matched to d1r89a1
    complexed with so4

Details for d2zh5a1

PDB Entry: 2zh5 (more details), 2.6 Å

PDB Description: Complex structure of AFCCA with tRNAminiDCU
PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2zh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zh5a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOP Domain Coordinates for d2zh5a1:

Click to download the PDB-style file with coordinates for d2zh5a1.
(The format of our PDB-style files is described here.)

Timeline for d2zh5a1: