SCOP 1.75: Domain d2zh4a2: 2zh4 A:1-142

Lineage for d2zh4a2 (2zh4 A:1-142)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families)

5. Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
   similar overall structure to poly(A) polymerase, PAP

6. Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (28 PDB entries)
   Uniprot O28126

8. Domain d2zh4a2: 2zh4 A:1-142 [154443]
   Other proteins in same PDB: d2zh4a1, d2zh4a3
   automatically matched to d1r89a2
   complexed with so4

Details for d2zh4a2

PDB Entry: 2zh4, 2.65 Å

PDB Description: Complex structure of AFCCA with tRNAminiDCG

PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2zh4a2:

Sequence; same for both SEQRES and ATOM records:

>d2zh4a2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

Timeline for d2zh4a2:

• d2zh4a2 is new in SCOP 1.75
  
• d2zh4a2 appears in SCOPe 2.01
  
• d2zh4a2 appears in the current release, SCOPe 2.08