SCOP 1.75: Domain d2zh2a1: 2zh2 A:143-257

Lineage for d2zh2a1 (2zh2 A:143-257)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (28 PDB entries)
   Uniprot O28126

8. Domain d2zh2a1: 2zh2 A:143-257 [154436]
   Other proteins in same PDB: d2zh2a2, d2zh2a3
   automatically matched to d1r89a1
   complexed with so4

Details for d2zh2a1

PDB Entry: 2zh2, 2.66 Å

PDB Description: Complex structure of AFCCA with tRNAminiDAC

PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2zh2a1:

Sequence; same for both SEQRES and ATOM records:

>d2zh2a1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d2zh2a1:

• d2zh2a1 is new in SCOP 1.75
  
• d2zh2a1 appears in SCOPe 2.01
  
• d2zh2a1 appears in the current release, SCOPe 2.08