SCOPe 2.05: Domain d2zgzb1: 2zgz B:1-157

Lineage for d2zgzb1 (2zgz B:1-157)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Plasmid segregation protein ParM [82438] (1 species)

7. Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)

8. Domain d2zgzb1: 2zgz B:1-157 [154431]
   automated match to d1mwma1
   complexed with gnp, mg

Details for d2zgzb1

PDB Entry: 2zgz, 2.25 Å

PDB Description: parm with gmppnp

PDB Compounds: (B:) Plasmid segregation protein parM

SCOPe Domain Sequences for d2zgzb1:

Sequence; same for both SEQRES and ATOM records:

>d2zgzb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

Timeline for d2zgzb1:

• d2zgzb1 first appeared in SCOP 1.75
  
• d2zgzb1 appears in SCOPe 2.04
  
• d2zgzb1 appears in SCOPe 2.06
  
• d2zgzb1 appears in the current release, SCOPe 2.08