Lineage for d2zgwa2 (2zgw A:1-188)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208816Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 2208825Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 2208826Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
    Uniprot O57883 1-188
  8. 2208833Domain d2zgwa2: 2zgw A:1-188 [154422]
    Other proteins in same PDB: d2zgwa1, d2zgwb1
    complexed with adn, btn; mutant

Details for d2zgwa2

PDB Entry: 2zgw (more details), 1.5 Å

PDB Description: crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a
PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2zgwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d2zgwa2:

Click to download the PDB-style file with coordinates for d2zgwa2.
(The format of our PDB-style files is described here.)

Timeline for d2zgwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zgwa1