SCOPe 2.01: Domain d2zgwa2: 2zgw A:1-188

Lineage for d2zgwa2 (2zgw A:1-188)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries)
   Uniprot O57883 1-188

8. Domain d2zgwa2: 2zgw A:1-188 [154422]
   Other proteins in same PDB: d2zgwa1, d2zgwb1
   complexed with adn, btn; mutant

Details for d2zgwa2

PDB Entry: 2zgw, 1.5 Å

PDB Description: crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a

PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2zgwa2:

Sequence; same for both SEQRES and ATOM records:

>d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d2zgwa2:

• d2zgwa2 first appeared in SCOP 1.75
  
• d2zgwa2 appears in SCOPe 2.02
  
• d2zgwa2 appears in the current release, SCOPe 2.08