Lineage for d2zgga1 (2zgg A:31-109)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048328Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 3048329Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 3048330Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 3048331Protein 3ank [83022] (2 species)
  7. 3048335Species Synthetic construct [TaxId:32630] [161330] (1 PDB entry)
  8. 3048336Domain d2zgga1: 2zgg A:31-109 [154420]
    automatically matched to d1n0qb_
    complexed with cd, co

Details for d2zgga1

PDB Entry: 2zgg (more details), 2 Å

PDB Description: asn-hydroxylation stabilises the ankyrin repeat domain fold
PDB Compounds: (A:) 3 repeat synthetic ankyrin

SCOPe Domain Sequences for d2zgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgga1 k.37.1.1 (A:31-109) 3ank {Synthetic construct [TaxId: 32630]}
aaragqddevrilmangadvaakdkngstplhlaarnghlevvkllleagadvnaqdkfg
ktafdisidngnedlaeil

SCOPe Domain Coordinates for d2zgga1:

Click to download the PDB-style file with coordinates for d2zgga1.
(The format of our PDB-style files is described here.)

Timeline for d2zgga1: