SCOPe 2.02: Domain d1dxub_: 1dxu B:

Lineage for d1dxub_ (1dxu B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (199 PDB entries)
   Uniprot P68871

8. Domain d1dxub_: 1dxu B: [15442]
   Other proteins in same PDB: d1dxua_, d1dxuc_
   complexed with hem, so4

Details for d1dxub_

PDB Entry: 1dxu, 1.7 Å

PDB Description: high-resolution x-ray study of deoxy recombinant human hemoglobins synthesized from beta-globins having mutated amino termini

PDB Compounds: (B:) hemoglobin (deoxy) (beta chain)

SCOPe Domain Sequences for d1dxub_:

Sequence; same for both SEQRES and ATOM records:

>d1dxub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1dxub_:

• d1dxub_ first appeared (with stable ids) in SCOP 1.55
  
• d1dxub_ appears in SCOPe 2.01
  
• d1dxub_ appears in SCOPe 2.03
  
• d1dxub_ appears in the current release, SCOPe 2.08