Lineage for d2zfla_ (2zfl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111781Species Mouse (Mus musculus) [TaxId:10090] [187256] (4 PDB entries)
  8. 2111784Domain d2zfla_: 2zfl A: [154417]
    automated match to d1i6ia_
    complexed with adp

Details for d2zfla_

PDB Entry: 2zfl (more details), 2.7 Å

PDB Description: crystal structure of the kif1a motor domain during mg release: mg- releasing transition-3
PDB Compounds: (A:) Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C

SCOPe Domain Sequences for d2zfla_:

Sequence, based on SEQRES records: (download)

>d2zfla_ c.37.1.9 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
edlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsk
lavtsyndiqdlmdsgnkprtvaatnmnetssrshavfniiftqkrhdaetnittekvsk
islvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktdf
ipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirn

Sequence, based on observed residues (ATOM records): (download)

>d2zfla_ c.37.1.9 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
asvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspe
dinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlc
edlfsrindttndnmsysvevsymeiycervrdllnpkngnlrvrehpllgpyvedlskl
avtsyndiqdlmdsgnkprtnmnetssrshavfniiftqkrhdaenittekvskislvdl
agseninkslttlgkvisalafipyrdsvltwllrengnsrtamvaalspadinydetls
tlryadrakqirn

SCOPe Domain Coordinates for d2zfla_:

Click to download the PDB-style file with coordinates for d2zfla_.
(The format of our PDB-style files is described here.)

Timeline for d2zfla_: